Recombinant bovine FGF-basic Food Grade 45 mL Tube

Cyclodextrine & Komplexe
Recombinant bovine FGF-basic Food Grade 45 mL Tube is a highly purified, food-grade basic fibroblast growth factor (bFGF, FGF-2) produced in Escherichia coli K12. Designed for use in the production of cultivated meat and other food applications, it meets stringent food safety and purity requirements.
Expression Host: Escherichia coli K12
Calculated Molecular Mass: 16,439 Da
Amino Acid Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIK GVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Sequence Reference: UniProt P03969-1

In detail, the solution contains the following ingredients:
  • Sodium chloride (CAS 7647-14-5)
  • Disodium hydrogen phosphate dihydrate (CAS 231-448-7)
  • bFGF (CAS 106096-93-9)
  • Dithiothreitol (CAS 3483-12-3)
  • Potassium dihydrogen phosphate (CAS 7778-77-0)
  • Potassium chloride (CAS 7447-40-7)
Download Vertriebskontakt

Eigenschaften

  • Food grade quality
  • High purity (HPLC) > 90%
  • Low endotoxins
  • Vegan and vegetarian
  • Allergen-free
  • Suitable for use in food production (e.g. cultivated meat)
  • Produced without animal-derived components
  • Manufactured according to Food Safety requirements
  • Origin of manufacturing is UK
Datenblätter
TDS Technisches Datenblatt
PDF 31,7 KB
Englisch

Recombinant bovine FGF-basic Food is intended for use in the production of cultivated meat and other food applications. For professional use in food processing and cellular agriculture.

Verpackung / Gebinde

Available in 45 mL PP tubes.

Lagerung

Store at -60 °C to -90 °C. Shelf life: at least 36 months at -80 °C. After thawing, keep refrigerated (3-8 °C) and use within 3 days. Avoid repeated freeze-thaw cycles.

Materialname Vertrieb durch Materialnummer Verpackung
Ergebnisse pro Seite

Vertrieb & Support

Wacker Chemie AG

Lautenschlagerstr. 23a

70173 Stuttgart

Deutschland

+49  711  61942-0


Distributoren

Es wurden leider keine Distributoren für dieses Produkt gefunden