Recombinant bovine FGF-basic Food

Recombinant bovine FGF-basic Food is a highly purified, food-grade basic fibroblast growth factor (bFGF, FGF-2) produced in Escherichia coli K12. Designed for use in the production of cultivated meat and other food applications, it meets stringent food safety and purity requirements.
Expression Host: Escherichia coli K12
Calculated Molecular Mass: 16,439 Da
Amino Acid Sequence: PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIK GVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGPKTGPGQKAILFLPMSAKS
Sequence Reference: UniProt P03969-1

In detail, the solution contains the following ingredients:
  • Sodium chloride (CAS 7647-14-5)
  • Disodium hydrogen phosphate dihydrate (CAS 231-448-7)
  • bFGF (CAS 106096-93-9)
  • Dithiothreitol (CAS 3483-12-3)
  • Potassium dihydrogen phosphate (CAS 7778-77-0)
  • Potassium chloride (CAS 7447-40-7)

Properties

  • Food grade quality
  • High purity (HPLC) > 90%
  • Low endotoxins
  • Vegan and vegetarian
  • Allergen-free
  • Suitable for use in food production (e.g. cultivated meat)
  • Produced without animal-derived components
  • Manufactured according to Food Safety requirements
  • Origin of manufacturing is UK
Data sheets

Recombinant bovine FGF-basic Food is intended for use in the production of cultivated meat and other food applications. For professional use in food processing and cellular agriculture.

Packaging

Available in 45 mL PP tubes.

Storage

Store at -60 °C to -90 °C. Shelf life: at least 36 months at -80 °C. After thawing, keep refrigerated (3-8 °C) and use within 3 days. Avoid repeated freeze-thaw cycles.

Sales and support

Wacker Chemie AG

Lautenschlagerstr. 23a

70173 Stuttgart

Germany

Distributors

No distributors were found for this product